All Primary Antibodies
Quantity
- (1)
- (2)
- (1)
- (3,051)
- (868)
- (1,753)
- (4,068)
- (1)
- (3)
- (1)
- (1,052)
- (632)
- (696,583)
- (11,661)
- (2)
- (549)
- (58)
- (1)
- (27)
- (3,647)
- (2,516)
- (1,449)
- (211)
- (1)
- (6)
- (11,811)
- (1,569)
- (4)
- (1)
- (7)
- (67)
- (5)
- (2,703)
- (3,673)
- (10,955)
- (1)
- (1)
- (4)
- (1)
- (239)
- (78)
- (8)
- (2,591)
- (471)
- (2)
- (7)
- (1)
- (136)
- (237)
- (3)
- (1)
- (12)
- (95)
- (1)
- (160,299)
- (202,154)
- (1)
- (24)
- (3)
- (798)
- (2)
- (10,393)
- (2)
- (123)
- (1)
- (4)
- (11)
- (4)
- (18)
- (1)
- (2)
- (5)
- (34)
- (3)
- (1)
- (38)
- (4)
- (1)
- (108)
- (1)
- (20)
- (11)
- (19)
- (6)
- (1)
- (1)
- (10,848)
- (589)
- (1)
- (2)
- (1)
- (9)
- (2)
- (2)
- (328)
- (361)
- (1)
- (5)
- (12,292)
- (2)
- (4,715)
- (1)
- (14)
- (1)
- (7)
- (5,780)
- (4,042)
- (1)
- (19)
- (1)
- (1)
- (2)
- (17,461)
- (16,185)
- (27)
- (1)
- (1)
- (2)
- (5,077)
- (1)
- (32)
- (4)
- (13)
- (77)
- (609)
- (17)
- (2)
- (1)
- (1)
- (1)
- (2,083)
- (1)
- (14)
- (3)
- (1)
- (1)
- (2)
- (7)
- (2)
- (2)
- (104)
- (1)
- (3,908)
- (2)
- (20)
- (5)
- (109)
- (1)
- (1)
- (5)
- (1)
- (1)
- (5)
- (198)
- (2)
- (8,810)
- (12)
- (2)
- (5)
- (9)
- (4)
- (2)
- (24)
- (111)
- (8,243)
- (32,842)
- (1,381)
- (53)
- (1,544)
- (21)
- (7)
- (1)
- (2,176)
- (1)
- (4,382)
- (24)
- (2)
- (1)
- (1)
- (7)
- (4)
- (38)
- (1)
- (1)
- (1)
- (709)
- (1)
- (1)
- (3)
- (4)
- (14)
- (3)
- (6)
- (1)
- (1)
Classification
- (100)
- (105)
- (655,840)
- (5)
- (11)
- (600,903)
- (24,608)
- (60)
- (544)
- (3)
Host Species
- (565)
- (2,335)
- (38)
- (1)
- (15)
- (1,519)
- (2)
- (2)
- (6)
- (4)
- (5)
- (75,868)
- (47)
- (161)
- (1,709)
- (13,888)
- (110)
- (8)
- (23)
- (471,874)
- (8)
- (1)
- (609,332)
- (69,253)
- (34,991)
- (171)
- (1)
- (1)
Conjugate
- (24,626)
- (9)
- (1)
- (20)
- (2,764)
- (74)
- (89)
- (275)
- (2)
- (53)
- (26,787)
- (26,543)
- (5)
- (27,752)
- (12)
- (26,560)
- (45)
- (93)
- (47)
- (26,868)
- (1)
- (27,608)
- (1)
- (3)
- (1)
- (71)
- (27,012)
- (26,777)
- (112)
- (107)
- (31)
- (128)
- (19)
- (123)
- (5)
- (103)
- (102)
- (2)
- (92)
- (1)
- (15)
- (5)
- (29,677)
- (10)
- (3)
- (222)
- (774)
- (1,037)
- (699)
- (762)
- (901)
- (866)
- (999)
- (841)
- (1,428)
- (890)
- (826)
- (1,041)
- (1,046)
- (1,045)
- (678)
- (1,053)
- (28,371)
- (121)
- (18)
- (57)
- (20)
- (1)
- (146)
- (1)
- (162)
- (1)
- (121)
- (24,636)
- (24,702)
- (25,079)
- (63)
- (24,665)
- (20,538)
- (1)
- (60)
- (24,592)
- (24,290)
- (24,234)
- (17)
- (9)
- (1)
- (1)
- (9)
- (5)
- (28,759)
- (5)
- (31)
- (1)
- (1)
- (338)
- (742)
- (25,519)
- (1)
- (28,905)
- (22,414)
- (17,684)
- (17,677)
- (22,400)
- (28,891)
- (38)
- (1)
- (4)
- (9)
- (12)
- (2)
- (103)
- (11)
- (22)
- (58)
- (28)
- (132)
- (171)
- (25)
- (90)
- (57)
- (14)
- (56)
- (73)
- (9)
- (78)
- (84)
- (99)
- (88)
- (90)
- (16)
- (64)
- (64)
- (40)
- (56)
- (50)
- (53)
- (109)
- (134)
- (41)
- (68)
- (65)
- (88)
- (70)
- (454)
- (25,824)
- (7)
- (4)
- (312)
- (313)
- (2,695)
- (3,525)
- (2)
- (3)
- (36)
- (210)
- (2,600)
- (94)
- (31)
- (24,136)
- (449)
- (535)
- (6)
- (12)
- (13)
- (5)
- (6)
- (1,229)
- (837)
- (158)
- (691)
- (784)
- (707)
- (727)
- (777)
- (711)
- (688)
- (48)
- (690)
- (645)
- (12)
- (29)
- (116)
- (6)
- (274)
- (251)
- (125)
- (126)
- (95)
- (46)
- (14)
- (5)
- (5)
- (9)
- (3)
- (10)
- (2)
- (64)
- (14)
- (438,691)
- (7)
- (188)
- (49)
- (2)
- (367)
- (71)
- (46)
- (25)
- (271)
- (3)
- (3)
- (4)
- (21,255)
- (21,212)
- (21,180)
Applications
- (94)
- (735)
- (415)
- (90)
- (5)
- (841)
- (113)
- (3)
- (1)
- (5,209)
- (1,003)
- (25)
- (5,007)
- (175)
- (390)
- (158)
- (6)
- (3)
- (13)
- (208)
- (60,069)
- (1)
- (93)
- (223)
- (150)
- (2,505)
- (2)
- (767)
- (349,724)
- (13,689)
- (13,217)
- (9,118)
- (50)
- (25)
- (127)
- (9)
- (264,158)
- (317)
- (9,932)
- (5)
- (6)
- (6)
- (1)
- (4)
- (19)
- (12,787)
- (23)
- (1)
- (197)
- (169)
- (7,617)
- (67)
- (4)
- (2)
- (98)
- (15)
- (29)
- (36)
- (3,096)
- (1,977)
- (221,618)
- (65,042)
- (156)
- (58)
- (171,295)
- (362,339)
- (77)
- (705)
- (27,993)
- (40)
- (12,809)
- (342,882)
- (19)
- (1)
- (86)
- (460)
- (96,894)
- (386)
- (11)
- (49)
- (322)
- (22)
- (312)
- (420)
- (169)
- (1,060)
- (26)
- (5,138)
- (605)
- (5)
- (6)
- (129)
- (253)
- (9)
- (319)
- (1,063)
- (34)
- (123)
- (6)
- (31,643)
- (1)
- (126)
- (16)
- (1,672)
- (39)
- (7,352)
- (2)
- (1)
- (317)
- (1)
- (87)
- (1,286)
- (13)
- (3)
- (16)
- (1,608)
- (1,086)
- (800)
- (658)
- (2,624)
- (468)
- (87)
- (7)
- (4)
- (2,048)
- (193)
- (1)
- (5)
- (1)
- (822,722)
- (4)
- (1,362)
- (1)
- (18)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
1,417,552
results
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), HRP
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | HRP |
| Applications | Western Blot |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with proprietary stabilizer and 0.07% Kathon; pH 7.2 |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Invitrogen™ beta Actin Loading Control Monoclonal Antibody (BA3R)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat,Rabbit,Chicken |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P29751, P60706, P60709, P60710, P60711 |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | beta Actin Loading Control |
| Gene Symbols | ACTB |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 0610041G09Rik; AA959943; AAT6; ACT; Act4; Act-4; ACT-5; ACTA; acta1; acta1b; ACTA2; Acta-2; ACTA3; actb; actb.L; actb1; actba; ACTC; actc1; Actc-1; actc1b; ACTE; Actg; ACTG1; Actg2; ACTGE; actin; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 1, skeletal muscle b; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin alpha cardiac muscle 1b; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin, alpha 1, skeletal muscle; actin, alpha 1b, skeletal muscle; actin, alpha 2, smooth muscle, aorta; Actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; actin, alpha cardiac muscle 1b; actin, alpha skeletal muscle; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta 1; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; actin, gamma 1; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha actin 1; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-smooth muscle actin; ASD5; ASMA; a-SMA; Bact; Bact; actin; B-actin; bactin1; bactin1 protein; bactzf; B-ACTZF; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin-1; BRWS1; BRWS2; cardiac muscle alpha actin 1; cardiofunk; cell growth-inhibiting gene 46 protein; Cfk; CFTD; CFTD1; CFTDM; CMD1R; CMH11; cytoplasmic 1; cytoplasmic beta-actin; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; E430023M04Rik; E51; epididymis luminal protein 176; fa27h01; fb83f06; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hm:zeh0631; I79_002310; I79_013242; I79_019066; LVNC4; MPFD; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; PS1TP5-binding protein 1; PS1TP5BP1; SHPM; similar to beta actin; skeletal alpha actin; skeletal alpha1 actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; vascular smooth muscle alpha-actin; VSCM; wu:fa27h01; wu:fb63d03; wu:fb83f06; wu:fd18f05; XELAEV_18045052mg; zeh0631 |
| Gene | ACTB |
| Product Type | Antibody |
| Gene ID (Entrez) | 100009272, 11461, 396526, 60, 81822 |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | Beta-actin N-terminal peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | BA3R |
Invitrogen™ CFTR Monoclonal Antibody (CF3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | P13569, P26361 |
| Isotype | IgM |
| Concentration | Conc. Not Determined |
| Antigen | CFTR |
| Gene Symbols | CFTR |
| Regulatory Status | RUO |
| Gene Alias | ABC35; Abcc7; ATP Binding Cassette Superfamily C Member 7 (ABCC7); ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; ATP-binding cassette, subfamily c, member 7; AW495489; cAMP-dependent chloride channel; CF; CFTR; CFTR/MRP; Channel conductance-controlling ATPase; cystic fibrosis transmembrane conductance regulator; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); cystic fibrosis transmembrane conductance regulator homolog; cystic fibrosis transmembrane conductance regulator homolog; ATP-binding cassette, subfamily c, member 7; dJ760C5.1; MRP7; RGD1561193; tcag7.78; TNR CFTR; TNR-CFTR |
| Gene | CFTR |
| Product Type | Antibody |
| Gene ID (Entrez) | 1080, 12638 |
| Formulation | Ascites with 0.05% sodium azide |
| Immunogen | Synthetic Peptide: G(103) R I I A S Y D P D N K E E R(117). |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | CF3 |
Invitrogen™ CD1c Monoclonal Antibody (L161), Alexa Fluor™ 647, eBioscience™
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | 4°C, store in dark, DO NOT FREEZE! |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 647 |
| Applications | Flow Cytometry |
| Form | Liquid |
| Gene Accession No. | P29017 |
| Isotype | IgG1 κ |
| Concentration | 5 μL/Test |
| Antigen | CD1c |
| Gene Symbols | CD1C |
| Regulatory Status | RUO |
| Purification Method | Affinity chromatography |
| Gene Alias | BDCA1; canCD1c; CD1; CD1A; CD1C; CD1C antigen, c polypeptide; CD1c molecule; cortical thymocyte antigen CD1C; differentiation antigen CD1-alpha-3; R7; RP11-101J8.3; T-cell surface glycoprotein CD1c |
| Gene | CD1C |
| Product Type | Antibody |
| Gene ID (Entrez) | 911 |
| Formulation | PBS with BSA and 0.09% sodium azide; pH 7.2 |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | L161 |
COX15 Antibody, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Rabbit Polyclonal Antibody
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | Q7KZN9-2 |
| Antigen | COX15 |
| Gene Symbols | COX15 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Molecular Weight of Antigen | 44 kDa |
| Gene Alias | COX15 (yeast) homolog, cytochrome c oxidase assembly protein, COX15 homolog, cytochrome c oxidase assembly protein (yeast), cytochrome c oxidase assembly protein COX15 homolog, cytochrome c oxidase subunit 15, EC 1.4.4.2, EC 3.1.3.5 |
| Gene ID (Entrez) | 1355 |
| Immunogen | Synthetic peptides corresponding to COX15(COX15 homolog, cytochrome c oxidase assembly protein (yeast)) The peptide sequence was selected from the N terminal of COX15. Peptide sequence DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with no preservative; pH 7.2 |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
Invitrogen™ 6x-His Tag Monoclonal Antibody (4E3D10H2/E3)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG1 |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with 1mg/mL BSA, 30% glycerol and 0.05% sodium azide |
| Immunogen | Mixture of N-terminal and C-terminal 6x-His peptides, CG-HHHHHH and HHHHHH-GC. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | 4E3D10H2/E3 |
Invitrogen™ 6x-His Tag Monoclonal Antibody (HIS.H8), Alexa Fluor™ 488
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Mouse Monoclonal Antibody
| Content And Storage | 4°C, do not freeze |
|---|---|
| Target Species | Tag |
| Host Species | Mouse |
| Conjugate | Alexa Fluor 488 |
| Applications | Western Blot,Immunocytochemistry |
| Form | Liquid |
| Isotype | IgG2b |
| Concentration | 1 mg/mL |
| Antigen | 6x-His Tag |
| Regulatory Status | RUO |
| Purification Method | Protein A |
| Gene Alias | 6His tag; 6X His; His Tag; Histidine Tag |
| Product Type | Antibody |
| Formulation | PBS with 1mg/mL BSA and 0.05% sodium azide |
| Immunogen | 6x His synthetic peptide. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | HIS.H8 |
SARS-CoV-2 Spike S1 Antibody (H4) - Azide and BSA Free, Novus Biologicals™
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Human Monoclonal Antibody
Invitrogen™ TOM20 Recombinant Rabbit Monoclonal Antibody (10G6I8)
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Greener Choice
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More
Rabbit Recombinant Monoclonal Antibody
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | ELISA,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry |
| Form | Liquid |
| Gene Accession No. | Q15388, Q62760, Q9DCC8 |
| Isotype | IgG |
| Concentration | 1 mg/mL |
| Antigen | TOM20 |
| Gene Symbols | TOMM20 |
| Regulatory Status | RUO |
| Purification Method | Affinity Chromatography |
| Gene Alias | 1810060K07Rik; BB284719; Gm19268; KIAA0016; MAS20; mitochondrial 20 kDa outer membrane protein; Mitochondrial import receptor subunit TOM20 homolog; mKIAA0016; MOM19; outer mitochondrial membrane receptor rTOM20; outer mitochondrial membrane receptor Tom20; TOM20; TOMM20; translocase of outer mitochondrial membrane 20; translocase of outer mitochondrial membrane 20 homolog (yeast); translocase of outer mitochondrial membrane 20 homolog type II |
| Gene | TOMM20 |
| Product Type | Antibody |
| Gene ID (Entrez) | 266601, 67952, 9804 |
| Formulation | PBS with 50% glycerol, 0.05% BSA and 0.09% sodium azide; pH 7.3 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1). |
| Classification | Recombinant Monoclonal |
| Primary or Secondary | Primary |
| Clone | 10G6I8 |
| Content And Storage | Stable for 1 year at -20°C from date of receipt. Handling Recommendations: Upon receipt and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. |
|---|---|
| Target Species | Bacteria |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunofluorescence,Western Blot |
| Form | Serum |
| Isotype | IgG |
| Research Discipline | Signaling |
| Antigen | FtsZ (GTPase) |
| Gene Symbols | FtsZ;BSU15290 |
| Regulatory Status | RUO |
| Purification Method | Unpurified |
| Dilution | Western Blotting Analysis: A representative lot detected FtsZ (GTPase) in Western Blotting applications (Lucet, I., et. al. (2000). EMBO J. 19(7):1467-75; Bisson-Filho, A.W., et. al. (2017). Science. 355(6326):739-743).Immunofluorescence Analysis: A representative lot detected FtsZ (GTPase) in Immunofluorescence applications (Daniel, R.A., et. al. (2000). Mol Microbiol. 35(2):299-311). |
| Gene Alias | Cell division protein FtsZ;Cell Division FtsZ GTPase |
| Gene ID (Entrez) | NP_389412 |
| Formulation | Rabbit polyclonal antiserum with 0.05% sodium azide. |
| Immunogen | Full length purified FtsZ from Bacillus subtilis. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | This rabbit polyclonal antibody detects Cell Division Protein FTsZ in Bacillus subtilis. |
Herpes simplex virus type 2 ICP8 Mouse anti-Herpes simplex virus, Clone: H2A024, Abnova™
Mouse Monoclonal Antibody
Herpes simplex virus ICP35 Mouse anti-Herpes simplex virus, Clone: P1102-2, Abnova™
Mouse Monoclonal Antibody
Herpes simplex virus type 2 gE Mouse anti-Herpes simplex virus, Clone: P1109, Abnova™
Mouse Monoclonal Antibody